Goat Sera
Vector Laboratories Normal Goat Serum Blocking Solution 20 ml
This product is made from sera collected from healthy adult goats. Serum pooled from several animals is heat-treated, centrifuged to remove precipitates and filtered. The sera are tested with the appropriate antibody to check for possible cross-reactivities and supplied undiluted with 0.08% sodium azide as a preservative. When diluted, this reagent can be used for blocking non-specific binding when goat secondary antibodies are used in immunohistochemistry (IHC) assays. It can also be used as an antibody diluent.
Abcam Normal Goat Serum, 50ML
Normal goat serum is used extensively for the blocking of non-specific antibody binding in tissue and cell staining, and in other applications of antibodies. - Cited in over 365 publications - Suitable for immunocytochemistry/immunofluorescence (ICC/IF), immunohistochemistry (IHC), and more - Superior Fc receptor blocking - Reduces background noise
The product is subject to the following: Abcam Restricted Use Statement
Innovative Research Inc Innovative Grade US Origin Mouse Balb C Serum, 10 ml, Serum, Whole blood collection, Balb C mouse
Innovative Research Inc.'s Innovative Grade US Origin Mouse Balb C Serum is a premium biological reagent designed to provide researchers with a highly consistent and reliable material crucial for various scientific applications. This serum is sourced from whole blood collected from Balb C mice of US origin and ensures high purity while delivering consistent performance for sensitive experiments.
- High purity and quality sourced from US Origin Balb C mice.
- Consistent performance processed for dependable and reproducible results.
- Specific strain sourcing ideal for studies in immunology and cancer research.
- Volume of 10 ml.
- Whole blood collection method.
- Storage recommendation: Use immediately or store at 4 °C for up to 24 hours after thawing.
- Freezing warning: Do not keep on ice or store below 0 °C to prevent clotting.
Vector Laboratories 2.5% Normal Goat Serum Blocking Solution 50 ml
2.5% Normal Goat Serum is used for blocking non-specific binding when goat secondary antibodies are used in immunohistochemistry assays. A ready-to-use solution, it is the same serum preparation that is included in the ImmPRESS Detection Systems. It can also be used as an antibody diluent. Vector produces this serum by collecting and pooling the sera from healthy adult goats, heat-treating and centrifuging the pool to remove precipitates, and then filtering to remove fine particulates. The serum is tested with antibodies to check for possible cross-reactivities and then diluted to 2.5% (v/v) in buffer containing 0.08% sodium azide.
Cayman Chemical EP4 ReceptrC-Term BlockIn 1ea
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) · To be used in conjunction with Cayman’s EP4 Receptor Polyclonal Antibody (Item No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.
American Research Products Inc Goat Serum amyloid A SAA ELI
Goat Serum amyloid A (SAA) ELISA Kit from CUSABIO Detection Range 100 ng/ml-8000 ng/ml Sensitivity 125 ng/ml Sample serum plasma Method Competitive
Cayman Chemical Precelys 24 Touch BlockIn 1ea
An accessory for the Precellys 24 Touch (Item No. 36769)
AUTOMATION TRAINER P30XL Beckman-Type 384-Format, Clear, Unfiltered, Non-Sterile, Racked
P30XL Beckman-Type 384-Format, Clear, Unfiltered, Non-Sterile, Racked
Bioworld Donor Goat serum, sterile filtered, 0.2 absolute, heat inactivated, 500 mL
Specially formulated for use as a diluent/buffer in ELISA test kits.Ideal as a blocking agent in Western blotting.Useful as tissue culture media supplement.Sterility tested.Endotoxin level: < 0.5 EU/ml.Mycoplasma testing upon request.Sterile filtered to 0.2 µmStorage Conditions: -20°C + 5°C.
Bioworld Donor Goat Serum, 100 mL
Donor caprine serum is especially intended for use as a diluent/buffer in ELISA test kits. It is ideal as a blocking agent for Western blots and is also useful as a tissue culture media supplement.SpecificationsSterile-filteredShips on dry ice.
S2 Media 5mL Normal Saline, 0.85% (w/v) NaCl Solution, Sterile, 16x125mm Borosilicate Glass Tube, 50/box
Normal Saline, 0.85% (w/v) NaCl Solution ready-to-use tubes are intended for use as a buffer solution, diluent, and in the preparation of bacterial suspensions. This product is not intended for growth promotion; therefore, growth performance testing with specified microorganisms is not indicated.• Normal Saline (0.85% NaCl) should be used by trained professionals within a laboratory setting. • Product is not intended for use in the diagnosis or treatment of disease or other human conditions.